PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_104030_mied.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 183aa    MW: 20869.1 Da    PI: 4.8114
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_104030_mied.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.43.2e-151391856
                        HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +F ++  p  ++++++A++l+L+ rqV+vWFqNrRa+ k
  Bv5_104030_mied.t1  1 MFSSEARPGSKTKQQIANQLELDPRQVSVWFQNRRARTK 39
                        5899999******************************98 PP

2HD-ZIP_I/II89.34.7e-292771893
         HD-ZIP_I/II 18 FeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                        F++e +  ++ K+++a++L+l+prqv vWFqnrRARtk+kq+E+dy++Lk++yd+l++e e+L+++++ L  el++
  Bv5_104030_mied.t1  2 FSSEARPGSKTKQQIANQLELDPRQVSVWFQNRRARTKSKQTEHDYSVLKARYDSLASEFEALKRDNQCLVIELQR 77
                        6677777899***********************************************************9988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0014145IPR001356Homeobox domain
PfamPF000461.2E-12139IPR001356Homeobox domain
PROSITE profilePS5007114.349141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-13248IPR009057Homeodomain-like
SuperFamilySSF466895.85E-12250IPR009057Homeodomain-like
CDDcd000862.96E-10842No hitNo description
PROSITE patternPS0002701639IPR017970Homeobox, conserved site
PfamPF021835.5E-174182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MFSSEARPGS KTKQQIANQL ELDPRQVSVW FQNRRARTKS KQTEHDYSVL KARYDSLASE  60
FEALKRDNQC LVIELQRLKD LKEWPKDSTT DSTPGTCSSN GESVSLGSAQ MDVARPEDYN  120
HEKILNEAKT EGFKIGQEID IQENINMIGS TDGSLASFSN HSSLEVTYLS EHNCVLDWWD  180
FWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13341RRARTKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676907.11e-136PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLA0A0J8CK511e-136A0A0J8CK51_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.18e-29homeobox 12